Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB2 Peptide - N-terminal region

HSPB2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSPB2

UniProt

Q16082

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPB2 Rabbit Polyclonal Antibody (orb580314) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001532

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC5A Adenovirus (Mouse)
49181054 1.0 mL

UNC5A Adenovirus (Mouse)

Sign In for Pricing
View Details
Apolipoprotein B (APOB) Antibody (Biotin)
abx271449-01 200 µL

Apolipoprotein B (APOB) Antibody (Biotin)

Sign In for Pricing
View Details
Apolipoprotein B (APOB) Antibody (Biotin)
abx271449-02 1 mL

Apolipoprotein B (APOB) Antibody (Biotin)

Sign In for Pricing
View Details
PIAS2 Antibody, HRP conjugated
CSB-PA13299B0Rb-01 50 µg

PIAS2 Antibody, HRP conjugated

Sign In for Pricing
View Details
PIAS2 Antibody, HRP conjugated
CSB-PA13299B0Rb-02 100 µg

PIAS2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Coramitug Biosimilar - Research Grade
ICH5449-5mg 5 mg

Coramitug Biosimilar - Research Grade

Sign In for Pricing
View Details