PSMA8 Peptide - middle region
PSMA8 Peptide - middle region
Product Specifications
Product Name Alternative
PSMA7L
UniProt
Q8TAA3
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PSMA8 Rabbit Polyclonal Antibody (orb325398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_653263
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISALIVGFDDDGISRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10397828 96 Well
Goat ADP ribosylation factor like protein 11 (ARL11) ELISA kit
Sign In for Pricing
View Details MBS1356045-01 0.02 mg (E-Coli)
Recombinant Pyrobaculum aerophilum Cytidylate kinase (cmk)
Sign In for Pricing
View Details MBS1356045-02 0.1 mg (E-Coli)
Recombinant Pyrobaculum aerophilum Cytidylate kinase (cmk)
Sign In for Pricing
View Details MBS1356045-03 0.02 mg (Yeast)
Recombinant Pyrobaculum aerophilum Cytidylate kinase (cmk)
Sign In for Pricing
View Details