Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA8 Peptide - middle region

PSMA8 Peptide - middle region

Product Specifications

Product Name Alternative

PSMA7L

UniProt

Q8TAA3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMA8 Rabbit Polyclonal Antibody (orb325398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653263

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISALIVGFDDDGISRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BND-35
T9901A-1047-01 1 mg

BND-35

Sign In for Pricing
View Details
BND-35
T9901A-1047-02 5 mg

BND-35

Sign In for Pricing
View Details
Recombinant Human FGFRL1 protein, C-His tag
IMP-1098 10 µg

Recombinant Human FGFRL1 protein, C-His tag

Sign In for Pricing
View Details
XCT CRISPR Activation Plasmid (m2)
sc-424104-ACT-2 20 µg

XCT CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
ALKBH8 Lentiviral Activation Particles (m)
sc-426676-LAC 200 µL

ALKBH8 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
PTP4A1 siRNA Oligos set (Human)
38127171 3x 5 nmol

PTP4A1 siRNA Oligos set (Human)

Sign In for Pricing
View Details