Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSAP Peptide - N-terminal region

GSAP Peptide - N-terminal region

Product Specifications

Product Name Alternative

GSAP, PION

UniProt

A4D1B5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSAP Rabbit Polyclonal Antibody (orb325416) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059135

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTRQNELLYTFEKDLQVFSCSVNSERTLLAASLVQSTKEGKRNELQPGSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ATF7 Antibody
RC-15258-01 50 μL

Recombinant ATF7 Antibody

Sign In for Pricing
View Details
Recombinant ATF7 Antibody
RC-15258-02 100 µL

Recombinant ATF7 Antibody

Sign In for Pricing
View Details
Recombinant ATF7 Antibody
RC-15258-03 1 mL

Recombinant ATF7 Antibody

Sign In for Pricing
View Details
Distillate Fuel Oils Oxidation Stability Tester (accelerated method) BPTL-267
BPTL-267 1 Unit

Distillate Fuel Oils Oxidation Stability Tester (accelerated method) BPTL-267

Sign In for Pricing
View Details
M SARS-CoV-2 Recombinant Protein
TP724026 100 µg

M SARS-CoV-2 Recombinant Protein

Sign In for Pricing
View Details
MMP8 Rabbit Polyclonal Antibody
AP06235PU-N 100 µg

MMP8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details