Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETD7 Peptide - N-terminal region

SETD7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SETD7, KIAA1717, KMT7, SET7, SET9

UniProt

Q8WTS6

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SETD7 Rabbit Polyclonal Antibody (orb580587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_085151

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (Nuclear Marker) (HH1/1784R), 1mg/mL
BNUM1784-50 1x 50 µL

Histone H1 (Nuclear Marker) (HH1/1784R), 1mg/mL

Sign In for Pricing
View Details
CUG BP1 (CELF1) (NM_006560) Human Recombinant Protein
TP306275 20 µg

CUG BP1 (CELF1) (NM_006560) Human Recombinant Protein

Sign In for Pricing
View Details
Bodi Fluor™ 576/589 NHS Ester (equivalent to BODIPY™ 576/589 NHS Ester)
661-AAT 5 mg

Bodi Fluor™ 576/589 NHS Ester (equivalent to BODIPY™ 576/589 NHS Ester)

Sign In for Pricing
View Details
APOL6 Polyclonal Antibody
E-AB-16261-01 20 µL

APOL6 Polyclonal Antibody

Sign In for Pricing
View Details
APOL6 Polyclonal Antibody
E-AB-16261-02 60 µL

APOL6 Polyclonal Antibody

Sign In for Pricing
View Details
APOL6 Polyclonal Antibody
E-AB-16261-03 120 µL

APOL6 Polyclonal Antibody

Sign In for Pricing
View Details