Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSGALNACT2 Peptide - N-terminal region

CSGALNACT2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CHGN2, ChGn-2, PRO0082, GALNACT2, GALNACT-2, beta4GalNAcT

UniProt

Q8N6G5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSGALNACT2 Rabbit Polyclonal Antibody (orb325473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005271877

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGVVGENYGKEYYQALLQEQEEHYQTRATSLKRQIAQLKQELQEMSEKMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-2-Microglobulin Antibody
KC-3917-01 50 μL

Beta-2-Microglobulin Antibody

Sign In for Pricing
View Details
Beta-2-Microglobulin Antibody
KC-3917-02 100 µL

Beta-2-Microglobulin Antibody

Sign In for Pricing
View Details
Beta-2-Microglobulin Antibody
KC-3917-03 1 mL

Beta-2-Microglobulin Antibody

Sign In for Pricing
View Details
TBX22 Antibody
8C11954-AAT 50 µg

TBX22 Antibody

Sign In for Pricing
View Details
Recombinant VCAM1 Antibody
RC-4057-01 50 μL

Recombinant VCAM1 Antibody

Sign In for Pricing
View Details
Recombinant VCAM1 Antibody
RC-4057-02 100 µL

Recombinant VCAM1 Antibody

Sign In for Pricing
View Details