Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSGALNACT2 Peptide - N-terminal region

CSGALNACT2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CHGN2, ChGn-2, PRO0082, GALNACT2, GALNACT-2, beta4GalNAcT

UniProt

Q8N6G5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSGALNACT2 Rabbit Polyclonal Antibody (orb325473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005271877

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGVVGENYGKEYYQALLQEQEEHYQTRATSLKRQIAQLKQELQEMSEKMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc9a2 Mouse Gene Knockout Kit (CRISPR)
KN516207 1 Kit

Slc9a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BenchRocker™ 2D Rocker, variable speed, 14"x12" platform with flat mat, 115V
BR2000 1 Each

BenchRocker™ 2D Rocker, variable speed, 14"x12" platform with flat mat, 115V

Sign In for Pricing
View Details
APE1 Mouse Monoclonal Antibody [12H1]
EM1801-11 100 µL

APE1 Mouse Monoclonal Antibody [12H1]

Sign In for Pricing
View Details
RFK Rabbit Polyclonal Antibody
TA369615 100 µL

RFK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glutathione Peroxidase 1 (GPX1) (C-term) Rabbit Polyclonal Antibody
AP51937PU-N 400 µL

Glutathione Peroxidase 1 (GPX1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details