Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG12 Peptide - N-terminal region

ALG12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALG12, PP14673

UniProt

Q9BV10

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG12 Rabbit Polyclonal Antibody (orb330599) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077010

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EESFNLQATHDLLYHWQDLEQYDHLEFPGVVPRTFLGPVVIAVFSSPAVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

90mm, Poly-D-lysine Coated, Dnase/Rnase-free, Non-pyrogenic, Sterilized, 5/pk, 20/inner box, 80/case
CELCUJGD040090A 80 Pieces/Case:5 Pieces/ PACKS:16 PACKS/CASE

90mm, Poly-D-lysine Coated, Dnase/Rnase-free, Non-pyrogenic, Sterilized, 5/pk, 20/inner box, 80/case

Sign In for Pricing
View Details
Human DLGAP3 Knockout HEK293T cell line
GTR15409326 1 Vial

Human DLGAP3 Knockout HEK293T cell line

Sign In for Pricing
View Details
TLR2 Antibody
orb1177166 100 µg

TLR2 Antibody

Sign In for Pricing
View Details
Aquaporin 5 Rabbit Monoclonal Antibody
E46F1370 40 µL

Aquaporin 5 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD2 Antibody
RD21796F-01 20 Tests

FITC Anti-Human CD2 Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD2 Antibody
RD21796F-02 100 Tests

FITC Anti-Human CD2 Antibody

Sign In for Pricing
View Details