Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG12 Peptide - N-terminal region

ALG12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALG12, PP14673

UniProt

Q9BV10

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG12 Rabbit Polyclonal Antibody (orb330599) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077010

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EESFNLQATHDLLYHWQDLEQYDHLEFPGVVPRTFLGPVVIAVFSSPAVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphoglucomutase-2 (PGM2) Antibody
abx236361 100 µg

Phosphoglucomutase-2 (PGM2) Antibody

Sign In for Pricing
View Details
Recombinant HIV-1 gp120 LAV Protein, Untagged, Insect-2ug
QP12245-2ug 2ug

Recombinant HIV-1 gp120 LAV Protein, Untagged, Insect-2ug

Sign In for Pricing
View Details
CDK10 Antibody
A12286-100UG 100 µg

CDK10 Antibody

Sign In for Pricing
View Details
MTH1 (7P13) Rabbit Monoclonal Antibody
E28M0677 100 µL

MTH1 (7P13) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TACR1 Antibody - C-terminal region
ARP77913_P050-25UL 25 µL

TACR1 Antibody - C-terminal region

Sign In for Pricing
View Details
2- (3-amino-1H-isoindol-1-ylidene) -3-oxo-3-piperidin-1-ylpropanenitrile
sc-343880A 1 g

2- (3-amino-1H-isoindol-1-ylidene) -3-oxo-3-piperidin-1-ylpropanenitrile

Sign In for Pricing
View Details