Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VMP1 Peptide - middle region

VMP1 Peptide - middle region

Product Specifications

Product Name Alternative

VMP1, TDC1, TMEM49, HSPC292

UniProt

Q96GC9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VMP1 Rabbit Polyclonal Antibody (orb330604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112200

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM16B Peptide
MBS153255-01 0.05 mg

TMEM16B Peptide

Sign In for Pricing
View Details
TMEM16B Peptide
MBS153255-02 5x 0.05 mg

TMEM16B Peptide

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS805834 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
RRAGB (Ras-related GTP-binding Protein B, Rag B, RagB) (HRP)
132842-HRP 100 µL

RRAGB (Ras-related GTP-binding Protein B, Rag B, RagB) (HRP)

Sign In for Pricing
View Details
Mouse Monoclonal CD3 Antibody (B-B11) [PE]
NBP3-14571PE 0.1 mL

Mouse Monoclonal CD3 Antibody (B-B11) [PE]

Sign In for Pricing
View Details
Chicken Macrophage Inflammatory Protein 1 Alpha (MIP-1α) ELISA Kit
NSL0497Ch 96 Tests

Chicken Macrophage Inflammatory Protein 1 Alpha (MIP-1α) ELISA Kit

Sign In for Pricing
View Details