Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VMP1 Peptide - middle region

VMP1 Peptide - middle region

Product Specifications

Product Name Alternative

VMP1, TDC1, TMEM49, HSPC292

UniProt

Q96GC9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VMP1 Rabbit Polyclonal Antibody (orb330604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112200

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLO1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61735R-BF488-TR 20 µL

GLO1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
GYPB Rabbit Polyclonal Antibody (RBITC)
orb1011470 100 µL

GYPB Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Phospho-MEK2 (Thr394) Rabbit Polyuclonal Antibody
E10G20267 100 µL

Phospho-MEK2 (Thr394) Rabbit Polyuclonal Antibody

Sign In for Pricing
View Details
FBXO24 (NM_012172) Human Over-expression Lysate
LC432328 20 µg

FBXO24 (NM_012172) Human Over-expression Lysate

Sign In for Pricing
View Details
HARS Recombinant Antibody, PE Conjugated
bsm-62552R-PE 100 µL

HARS Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
POLDIP1 (KCTD13) (NM_178863) Human Over-expression Lysate
LH15680V 100 µg

POLDIP1 (KCTD13) (NM_178863) Human Over-expression Lysate

Sign In for Pricing
View Details