LIN28B Peptide - C-terminal region
LIN28B Peptide - C-terminal region
Product Specifications
Product Name Alternative
CSDD2
UniProt
Q6ZN17
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LIN28B Rabbit Polyclonal Antibody (orb325570) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004317
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GCTSPPFPQEARAEISERSGRSPQEASSTKSSIAPEEQSKKGPSVQKRKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
QP11682-50ug 50ug
Recombinant other DnaK Protein, Untagged, E.coli-50ug
Sign In for Pricing
View Details MBS1030973-01 0.02 mg (E-Coli)
Recombinant Salmonella newport Glutathione-regulated potassium-efflux system ancillary protein kefF (kefF)
Sign In for Pricing
View Details MBS1030973-02 0.1 mg (E-Coli)
Recombinant Salmonella newport Glutathione-regulated potassium-efflux system ancillary protein kefF (kefF)
Sign In for Pricing
View Details MBS1030973-03 0.02 mg (Yeast)
Recombinant Salmonella newport Glutathione-regulated potassium-efflux system ancillary protein kefF (kefF)
Sign In for Pricing
View Details MBS1030973-04 0.1 mg (Yeast)
Recombinant Salmonella newport Glutathione-regulated potassium-efflux system ancillary protein kefF (kefF)
Sign In for Pricing
View Details MBS1030973-05 0.02 mg (Baculovirus)
Recombinant Salmonella newport Glutathione-regulated potassium-efflux system ancillary protein kefF (kefF)
Sign In for Pricing
View Details