Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF284 Peptide - C-terminal region

ZNF284 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZNF284L

UniProt

Q2VY69

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF284 Rabbit Polyclonal Antibody (orb325580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_006723250

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCGKSSEHSSCLQDQQSDHSGEKTSKCEDCGKRYERRLNLDMILSLFLND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) CDR2L Polyclonal Antibody
MBS7138499 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) CDR2L Polyclonal Antibody

Sign In for Pricing
View Details
KCNIP2 (Kv Channel-interacting Protein 2, KChIP2, A-type Potassium Channel Modulatory Protein 2, Cardiac Voltage-gated Potassium Channel Modulatory Subunit, Potassium Channel-interacting Protein 2, DKFZp566L1246, MGC17241) (MaxLight 650)
128744-ML650 100 µL

KCNIP2 (Kv Channel-interacting Protein 2, KChIP2, A-type Potassium Channel Modulatory Protein 2, Cardiac Voltage-gated Potassium Channel Modulatory Subunit, Potassium Channel-interacting Protein 2, DKFZp566L1246, MGC17241) (MaxLight 650)

Sign In for Pricing
View Details
STK39 Antibody
AF6517-01 100 µL

STK39 Antibody

Sign In for Pricing
View Details
STK39 Antibody
AF6517-02 200 µL

STK39 Antibody

Sign In for Pricing
View Details
OPCA00359-100UG - Recombinant human Rab GDP dissociation inhibitor beta protein
OPCA00359-100UG 100 µg

OPCA00359-100UG - Recombinant human Rab GDP dissociation inhibitor beta protein

Sign In for Pricing
View Details
MUC6 Protein Vector (Mouse) (pPM-C-HA)
31141024 500 ng

MUC6 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details