Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF284 Peptide - C-terminal region

ZNF284 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZNF284L

UniProt

Q2VY69

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF284 Rabbit Polyclonal Antibody (orb325580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_006723250

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCGKSSEHSSCLQDQQSDHSGEKTSKCEDCGKRYERRLNLDMILSLFLND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Telomerase (TE) ELISA Kit
MBS3805380-01 48 Well

Mouse Telomerase (TE) ELISA Kit

Sign In for Pricing
View Details
Mouse Telomerase (TE) ELISA Kit
MBS3805380-02 96 Well

Mouse Telomerase (TE) ELISA Kit

Sign In for Pricing
View Details
Mouse Telomerase (TE) ELISA Kit
MBS3805380-03 5x 96 Well

Mouse Telomerase (TE) ELISA Kit

Sign In for Pricing
View Details
Mouse Telomerase (TE) ELISA Kit
MBS3805380-04 10x 96 Well

Mouse Telomerase (TE) ELISA Kit

Sign In for Pricing
View Details
AGFG1 Knockout NCI-H1975 Polyclonal Cells
ARG31051 1 Million

AGFG1 Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
3-Aminopropyl-24,25-dihydroxy Vitamin D2
TRC-A628335-0.25MG 0.25 mg

3-Aminopropyl-24,25-dihydroxy Vitamin D2

Sign In for Pricing
View Details