Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOTO Peptide - C-terminal region

NOTO Peptide - C-terminal region

Product Specifications

Product Name Alternative

NOTO

UniProt

A8MTQ0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOTO Rabbit Polyclonal Antibody (orb581265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001127934

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CSGLWAFPDWAPTEDLQDTERQQKRVRTMFNLEQLEELEKVFAKQHNLVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pask sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
36048116 3x 1.0 µg

Pask sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PAQR3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1593306 1.0 µg DNA

PAQR3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
SHARP1 (BHLHE41) Mouse Monoclonal Antibody [Clone:11F6]
E45M17289 100 µg

SHARP1 (BHLHE41) Mouse Monoclonal Antibody [Clone:11F6]

Sign In for Pricing
View Details
Grin2a Antibody
orb1273649 0.1 mL

Grin2a Antibody

Sign In for Pricing
View Details
Nova1 Rabbit mAb
F3208-20uL 20 µL

Nova1 Rabbit mAb

Sign In for Pricing
View Details
TC-PTP (F-8) HRP
sc-373835 HRP 200 µg/mL

TC-PTP (F-8) HRP

Sign In for Pricing
View Details