Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOTO Peptide - C-terminal region

NOTO Peptide - C-terminal region

Product Specifications

Product Name Alternative

NOTO

UniProt

A8MTQ0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOTO Rabbit Polyclonal Antibody (orb581265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001127934

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CSGLWAFPDWAPTEDLQDTERQQKRVRTMFNLEQLEELEKVFAKQHNLVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MET16 rabbit pAb
E28PN3138 100 µL

MET16 rabbit pAb

Sign In for Pricing
View Details
Ccndbp1 AAV siRNA Pooled Vector
15395166 1.0 µg

Ccndbp1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
DEFB115 Protein Vector (Human) (pPB-C-His)
PV072721 500 ng

DEFB115 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rat Alpha-(1,3)-Fucosyltransferase 11 (FUT11) ELISA Kit
MBS7254844-01 48 Well

Rat Alpha-(1,3)-Fucosyltransferase 11 (FUT11) ELISA Kit

Sign In for Pricing
View Details
Rat Alpha-(1,3)-Fucosyltransferase 11 (FUT11) ELISA Kit
MBS7254844-02 96 Well

Rat Alpha-(1,3)-Fucosyltransferase 11 (FUT11) ELISA Kit

Sign In for Pricing
View Details
Rat Alpha-(1,3)-Fucosyltransferase 11 (FUT11) ELISA Kit
MBS7254844-03 5x 96 Well

Rat Alpha-(1,3)-Fucosyltransferase 11 (FUT11) ELISA Kit

Sign In for Pricing
View Details