Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DECR1 Peptide - middle region

DECR1 Peptide - middle region

Product Specifications

Product Name Alternative

DECR, NADPH, SDR18C1

UniProt

Q16698

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DECR1 Rabbit Polyclonal Antibody (orb325706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001350

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) CEG1 Polyclonal Antibody
MBS7150245 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) CEG1 Polyclonal Antibody

Sign In for Pricing
View Details
Rhesus CLEC5A Protein, His Tag
PM252 20 µg

Rhesus CLEC5A Protein, His Tag

Sign In for Pricing
View Details
MLH1 Antibody, FITC conjugated
A46581-50UG 50 µg

MLH1 Antibody, FITC conjugated

Sign In for Pricing
View Details
POFUT2, ID (POFUT2, C21orf80, FUT13, KIAA0958, GDP-fucose protein O-fucosyltransferase 2, Peptide-O-fucosyltransferase 2) (MaxLight 550)
MBS6335539-01 0.1 mL

POFUT2, ID (POFUT2, C21orf80, FUT13, KIAA0958, GDP-fucose protein O-fucosyltransferase 2, Peptide-O-fucosyltransferase 2) (MaxLight 550)

Sign In for Pricing
View Details
POFUT2, ID (POFUT2, C21orf80, FUT13, KIAA0958, GDP-fucose protein O-fucosyltransferase 2, Peptide-O-fucosyltransferase 2) (MaxLight 550)
MBS6335539-02 5x 0.1 mL

POFUT2, ID (POFUT2, C21orf80, FUT13, KIAA0958, GDP-fucose protein O-fucosyltransferase 2, Peptide-O-fucosyltransferase 2) (MaxLight 550)

Sign In for Pricing
View Details
pCMV-BTC-3×FLAG-Neo Plasmid
PVT57203 2 µg

pCMV-BTC-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details