DECR1 Peptide - middle region
DECR1 Peptide - middle region
Product Specifications
Product Name Alternative
DECR, NADPH, SDR18C1
UniProt
Q16698
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DECR1 Rabbit Polyclonal Antibody (orb325706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001350
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1303717-01 0.02 mg (E-Coli)
Recombinant Xylella fastidiosa Type III pantothenate kinase (coaX)
Sign In for Pricing
View Details MBS1303717-02 0.1 mg (E-Coli)
Recombinant Xylella fastidiosa Type III pantothenate kinase (coaX)
Sign In for Pricing
View Details MBS1303717-03 0.02 mg (Yeast)
Recombinant Xylella fastidiosa Type III pantothenate kinase (coaX)
Sign In for Pricing
View Details MBS1303717-04 0.1 mg (Yeast)
Recombinant Xylella fastidiosa Type III pantothenate kinase (coaX)
Sign In for Pricing
View Details MBS1303717-05 0.02 mg (Baculovirus)
Recombinant Xylella fastidiosa Type III pantothenate kinase (coaX)
Sign In for Pricing
View Details MBS1303717-06 0.02 mg (Mammalian-Cell)
Recombinant Xylella fastidiosa Type III pantothenate kinase (coaX)
Sign In for Pricing
View Details