Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRYBA1 Peptide - C-terminal region

CRYBA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CRYB1, CTRCT10

UniProt

P05813

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRYBA1 Rabbit Polyclonal Antibody (orb325715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005199

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGAWVCYQYPGYRGYQYILECDHHGGDYKHWREWGSHAQTSQIQSIRRIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IAV H3N2 Hemagglutinin 1 (aa 17-346) (A/Victoria/361/2011) [His]
DAG2266 100 µg

IAV H3N2 Hemagglutinin 1 (aa 17-346) (A/Victoria/361/2011) [His]

Sign In for Pricing
View Details
Transcription factor E2F4 Immunizing Peptide
orb737925 100 µg

Transcription factor E2F4 Immunizing Peptide

Sign In for Pricing
View Details
GGT6 Human Over-expression Lysate
orb1353695 100 µg

GGT6 Human Over-expression Lysate

Sign In for Pricing
View Details
Tris (Hydroxy Methyl) Amino Methane 99.0%
251235-01 25 Kg

Tris (Hydroxy Methyl) Amino Methane 99.0%

Sign In for Pricing
View Details
Tris (Hydroxy Methyl) Amino Methane 99.0%
251235-02 100 g

Tris (Hydroxy Methyl) Amino Methane 99.0%

Sign In for Pricing
View Details
Tris (Hydroxy Methyl) Amino Methane 99.0%
251235-03 500 g

Tris (Hydroxy Methyl) Amino Methane 99.0%

Sign In for Pricing
View Details