Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRYBA1 Peptide - C-terminal region

CRYBA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CRYB1, CTRCT10

UniProt

P05813

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRYBA1 Rabbit Polyclonal Antibody (orb325715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005199

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGAWVCYQYPGYRGYQYILECDHHGGDYKHWREWGSHAQTSQIQSIRRIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PSMA (FOLH1) (NM_004476) AAV Particle
RC218310A1V 250 µL

Human PSMA (FOLH1) (NM_004476) AAV Particle

Sign In for Pricing
View Details
AMPK alpha 1(Phospho-Ser485) Rabbit Polyclonal Antibody
JOT-AP00381-01 20 µL

AMPK alpha 1(Phospho-Ser485) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AMPK alpha 1(Phospho-Ser485) Rabbit Polyclonal Antibody
JOT-AP00381-02 50 μL

AMPK alpha 1(Phospho-Ser485) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AMPK alpha 1(Phospho-Ser485) Rabbit Polyclonal Antibody
JOT-AP00381-03 100 µL

AMPK alpha 1(Phospho-Ser485) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Anti-NT-proBNP/NPPB antibody
SLM-10879M-01 50 µL

Mouse Anti-NT-proBNP/NPPB antibody

Sign In for Pricing
View Details
Mouse Anti-NT-proBNP/NPPB antibody
SLM-10879M-02 100 µL

Mouse Anti-NT-proBNP/NPPB antibody

Sign In for Pricing
View Details