Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RABL2A Peptide - middle region

RABL2A Peptide - middle region

Product Specifications

UniProt

Q9UBK7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RABL2A Rabbit Polyclonal Antibody (orb325731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_006712280

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSTWYTELREFRPEIPCIVVANKIDDINVTQKSFNFAKKFSLPLYFVSAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Csnk1g3 (NM_152809) Mouse Tagged ORF Clone Lentiviral Particle
MR217544L3V 200 µL

Csnk1g3 (NM_152809) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ITGA3 Antibody
CSB-PA003045-01 50 µg

ITGA3 Antibody

Sign In for Pricing
View Details
ITGA3 Antibody
CSB-PA003045-02 100 µg

ITGA3 Antibody

Sign In for Pricing
View Details
Anti-CD152 Antibody-FITC labled
MBS8321520-01 25 Assays

Anti-CD152 Antibody-FITC labled

Sign In for Pricing
View Details
Anti-CD152 Antibody-FITC labled
MBS8321520-02 100 Assays

Anti-CD152 Antibody-FITC labled

Sign In for Pricing
View Details
Anti-CD152 Antibody-FITC labled
MBS8321520-03 5x 100 Assays

Anti-CD152 Antibody-FITC labled

Sign In for Pricing
View Details