Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RABL2A Peptide - middle region

RABL2A Peptide - middle region

Product Specifications

UniProt

Q9UBK7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RABL2A Rabbit Polyclonal Antibody (orb325731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_006712280

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSTWYTELREFRPEIPCIVVANKIDDINVTQKSFNFAKKFSLPLYFVSAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), Biotin conjugate, 0.1mg/mL
BNCB1991-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PIBF1 Antibody, FITC conjugated
A77132-100UL 100 µL

PIBF1 Antibody, FITC conjugated

Sign In for Pricing
View Details
RQ-00311651
MBS5774483 Inquire

RQ-00311651

Sign In for Pricing
View Details
Tex21-set siRNA/shRNA/RNAi Lentivector (Mouse)
46536094 4x 500 ng

Tex21-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
CD40 (H-10) Alexa Fluor® 790
sc-13128 AF790 200 µg/mL

CD40 (H-10) Alexa Fluor® 790

Sign In for Pricing
View Details
Integrin alphaL discontinued
537995-01 30ul

Integrin alphaL discontinued

Sign In for Pricing
View Details