Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINDOC Peptide - N-terminal region

SPINDOC Peptide - N-terminal region

Product Specifications

Product Name Alternative

C11orf84, SPIN-DOC

UniProt

Q9BUA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPINDOC Rabbit Polyclonal Antibody (orb325758) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612480

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEQHPHTLDLSPSEKSNILEAWSEGVALLQDVRAEQPSPPNSDSGQDAHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDM2, Phosphorylated (S260) (Murine Double Minute-2, HDMX, HDM2, ACTFS, MGC5370, MGC71221) (MaxLight 405)
MBS6426402-01 0.1 mL

MDM2, Phosphorylated (S260) (Murine Double Minute-2, HDMX, HDM2, ACTFS, MGC5370, MGC71221) (MaxLight 405)

Sign In for Pricing
View Details
MDM2, Phosphorylated (S260) (Murine Double Minute-2, HDMX, HDM2, ACTFS, MGC5370, MGC71221) (MaxLight 405)
MBS6426402-02 5x 0.1 mL

MDM2, Phosphorylated (S260) (Murine Double Minute-2, HDMX, HDM2, ACTFS, MGC5370, MGC71221) (MaxLight 405)

Sign In for Pricing
View Details
BNIP3 (BCL2 Adenovirus E1B 19kDa Interacting Protein 3, BCL2/adenovirus E1B 19kD Protein Interacting Protein 3, NIP3) (HRP)
MBS6371369-01 0.1 mL

BNIP3 (BCL2 Adenovirus E1B 19kDa Interacting Protein 3, BCL2/adenovirus E1B 19kD Protein Interacting Protein 3, NIP3) (HRP)

Sign In for Pricing
View Details
BNIP3 (BCL2 Adenovirus E1B 19kDa Interacting Protein 3, BCL2/adenovirus E1B 19kD Protein Interacting Protein 3, NIP3) (HRP)
MBS6371369-02 5x 0.1 mL

BNIP3 (BCL2 Adenovirus E1B 19kDa Interacting Protein 3, BCL2/adenovirus E1B 19kD Protein Interacting Protein 3, NIP3) (HRP)

Sign In for Pricing
View Details
KRT8P15 sgRNA CRISPR Lentivector set (Human)
K1167301 3x 1.0 µg

KRT8P15 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
6''-O-xylosyl-glycitin
MBS5786985 Inquire

6''-O-xylosyl-glycitin

Sign In for Pricing
View Details