Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINDOC Peptide - N-terminal region

SPINDOC Peptide - N-terminal region

Product Specifications

Product Name Alternative

C11orf84, SPIN-DOC

UniProt

Q9BUA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPINDOC Rabbit Polyclonal Antibody (orb325758) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612480

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEQHPHTLDLSPSEKSNILEAWSEGVALLQDVRAEQPSPPNSDSGQDAHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC28A ORF Vector (Human) (pORF)
ORF001977 1.0 µg DNA

CCDC28A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Goat Polyclonal Apolipoprotein C1 Antibody
NB400-154 0.2 mg

Goat Polyclonal Apolipoprotein C1 Antibody

Sign In for Pricing
View Details
Lentiviral human KDM6A shRNA (UAS) - Lentiviral human KDM6A shRNA (UAS, RFP) (25)
GTR15311486 1 Vial

Lentiviral human KDM6A shRNA (UAS) - Lentiviral human KDM6A shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
SEC23IP Antibody, Biotin conjugated
A72207-100UG 100 µg

SEC23IP Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse IL-1 Alpha/IL-1F1/IL1A ELISA Kit EZ-Set (DIY Antibody Pairs)
MBS1756345-01 5 Plates

Mouse IL-1 Alpha/IL-1F1/IL1A ELISA Kit EZ-Set (DIY Antibody Pairs)

Sign In for Pricing
View Details
Mouse IL-1 Alpha/IL-1F1/IL1A ELISA Kit EZ-Set (DIY Antibody Pairs)
MBS1756345-02 5x 5 Plates

Mouse IL-1 Alpha/IL-1F1/IL1A ELISA Kit EZ-Set (DIY Antibody Pairs)

Sign In for Pricing
View Details