GSS Peptide - N-terminal region
GSS Peptide - N-terminal region
Product Specifications
Product Name Alternative
GSHS, HEL-S-64p, HEL-S-88n
UniProt
P48637
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GSS Rabbit Polyclonal Antibody (orb325906) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005260463
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6180177-01 0.1 mL
ZIC4 (Zic Family Member 4, FLJ42609, FLJ45833) (HRP)
Sign In for Pricing
View Details MBS6180177-02 5x 0.1 mL
ZIC4 (Zic Family Member 4, FLJ42609, FLJ45833) (HRP)
Sign In for Pricing
View Details FAB5762L 0.5 mL
Rat Monoclonal L-Selectin/CD62L Antibody (95226) [DyLight 550]
Sign In for Pricing
View Details 
126719-APC 100 µL
FCER1A (High Affinity Immunoglobulin epsilon Receptor Subunit alpha, Fc-epsilon RI-alpha, FcERI, IgE Fc Receptor Subunit alpha, FCE1A) (APC)
Sign In for Pricing
View Details