Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRN Peptide - middle region

GRN Peptide - middle region

Product Specifications

Product Name Alternative

GRN

UniProt

P28799

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRN Rabbit Polyclonal Antibody (orb330767) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN2AIPNL (NM_080656) Human Tagged ORF Clone Lentiviral Particle
RC202976L4V 200 µL

CDKN2AIPNL (NM_080656) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CER1 (Cerberus, Cerberus-related Protein, DAN Domain Family Member 4, DAND4) (MaxLight 750)
MBS6232112-01 0.1 mL

CER1 (Cerberus, Cerberus-related Protein, DAN Domain Family Member 4, DAND4) (MaxLight 750)

Sign In for Pricing
View Details
CER1 (Cerberus, Cerberus-related Protein, DAN Domain Family Member 4, DAND4) (MaxLight 750)
MBS6232112-02 5x 0.1 mL

CER1 (Cerberus, Cerberus-related Protein, DAN Domain Family Member 4, DAND4) (MaxLight 750)

Sign In for Pricing
View Details
Human azoR protein
orb604496-01 20 µg

Human azoR protein

Sign In for Pricing
View Details
Human azoR protein
orb604496-02 100 µg

Human azoR protein

Sign In for Pricing
View Details
Human azoR protein
orb604496-03 1 mg

Human azoR protein

Sign In for Pricing
View Details