Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRN Peptide - middle region

GRN Peptide - middle region

Product Specifications

Product Name Alternative

GRN

UniProt

P28799

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRN Rabbit Polyclonal Antibody (orb330767) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRB2 Adenovirus (Mouse)
22644054 1.0 mL

GRB2 Adenovirus (Mouse)

Sign In for Pricing
View Details
COX4I1 Antibody
orb69309 100 µL

COX4I1 Antibody

Sign In for Pricing
View Details
Recombinant Human SV2C Protein - (Dry Ice)
H00022987-P01-2ug 2 µg

Recombinant Human SV2C Protein - (Dry Ice)

Sign In for Pricing
View Details
PARD3 (NM_001184790) Human Tagged ORF Clone Lentiviral Particle
RC230686L3V 200 µL

PARD3 (NM_001184790) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal TANC1 Antibody [HRP]
NBP1-52630H 0.1 mL

Rabbit Polyclonal TANC1 Antibody [HRP]

Sign In for Pricing
View Details
GNMT (C-term) Mouse mAb
E2618311 100 µL

GNMT (C-term) Mouse mAb

Sign In for Pricing
View Details