HOOK2 Peptide - middle region
HOOK2 Peptide - middle region
Product Specifications
Product Name Alternative
HOOK2
UniProt
Q96ED9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HOOK2 Rabbit Polyclonal Antibody (orb582554) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_037444
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LRRAGSLRAQLEAQRRQVQELQGQRQEEAMKAEKWLFECRNLEEKYESVT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb3172595-01 1 mg
7-hydroxy-3- (2-hydroxypropyl) -5-methyl-1H-isochromen-1-one
Sign In for Pricing
View Details orb3172595-02 2 mg
7-hydroxy-3- (2-hydroxypropyl) -5-methyl-1H-isochromen-1-one
Sign In for Pricing
View Details orb3172595-03 3 mg
7-hydroxy-3- (2-hydroxypropyl) -5-methyl-1H-isochromen-1-one
Sign In for Pricing
View Details orb3172595-04 4 mg
7-hydroxy-3- (2-hydroxypropyl) -5-methyl-1H-isochromen-1-one
Sign In for Pricing
View Details orb3172595-05 5 mg
7-hydroxy-3- (2-hydroxypropyl) -5-methyl-1H-isochromen-1-one
Sign In for Pricing
View Details 