Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDC4 Peptide - N-terminal region

KHDC4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BLOM7, KIAA0907, SNORA80EHG

UniProt

Q7Z7F0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KHDC4 Rabbit Polyclonal Antibody (orb325962) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055764

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTREL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal IL-9 Antibody (RM9A4) [Alexa Fluor 488]
NBP3-12023AF488 0.1 mL

Rabbit Monoclonal IL-9 Antibody (RM9A4) [Alexa Fluor 488]

Sign In for Pricing
View Details
LY2801653 dihydrochloride 50mg
A15150-50 50 mg

LY2801653 dihydrochloride 50mg

Sign In for Pricing
View Details
KIF5C siRNA (Mouse)
MBS8237099-01 15 nmol

KIF5C siRNA (Mouse)

Sign In for Pricing
View Details
KIF5C siRNA (Mouse)
MBS8237099-02 30 nmol

KIF5C siRNA (Mouse)

Sign In for Pricing
View Details
KIF5C siRNA (Mouse)
MBS8237099-03 5x 30 nmol

KIF5C siRNA (Mouse)

Sign In for Pricing
View Details
LNP (LNPK) (NM_030650) Human Tagged Lenti ORF Clone
RC213378L1 10 µg

LNP (LNPK) (NM_030650) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details