MRPS33 Peptide - middle region
MRPS33 Peptide - middle region
Product Specifications
Product Name Alternative
S33mt, PTD003, CGI-139, MRP-S33
UniProt
Q9Y291
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRPS33 Rabbit Polyclonal Antibody (orb583677) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_444263
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15133420 1 Vial
Lentiviral human ETV2 shRNA (UAS) - Lentiviral human ETV2 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details