Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMKV Peptide - C-terminal region

CAMKV Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAMKV

UniProt

Q8NCB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAMKV Rabbit Polyclonal Antibody (orb584148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LATKAAATPEPAMAQPDSTAPEGATGQAPPSSKGEEAAGYAQESQREEAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp764 ORF Vector (Mouse) (pORF)
51119015 1.0 µg DNA

Zfp764 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Anti-EFNA1 Polyclonal Antibody
HB164014-01 50 µg

Anti-EFNA1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-EFNA1 Polyclonal Antibody
HB164014-02 100 µg

Anti-EFNA1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Superoxide dismutase [Mn/Fe] 1 (sodA)
MBS1426415-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Superoxide dismutase [Mn/Fe] 1 (sodA)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Superoxide dismutase [Mn/Fe] 1 (sodA)
MBS1426415-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Superoxide dismutase [Mn/Fe] 1 (sodA)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Superoxide dismutase [Mn/Fe] 1 (sodA)
MBS1426415-03 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Superoxide dismutase [Mn/Fe] 1 (sodA)

Sign In for Pricing
View Details