Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMKV Peptide - C-terminal region

CAMKV Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAMKV

UniProt

Q8NCB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAMKV Rabbit Polyclonal Antibody (orb584148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LATKAAATPEPAMAQPDSTAPEGATGQAPPSSKGEEAAGYAQESQREEAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHGDH (NM_006623) Human Recombinant Protein
TP303949M 100 µg

PHGDH (NM_006623) Human Recombinant Protein

Sign In for Pricing
View Details
PGLS antibody - middle region (ARP58513_P050)
ARP58513_P050 100 µL

PGLS antibody - middle region (ARP58513_P050)

Sign In for Pricing
View Details
DARPP32 Rabbit pAb
E47R2762 100 µL

DARPP32 Rabbit pAb

Sign In for Pricing
View Details
1- (4-Methylphenyl) cyclopentanecarbonyl chloride
OR1003052-01 250 mg

1- (4-Methylphenyl) cyclopentanecarbonyl chloride

Sign In for Pricing
View Details
1- (4-Methylphenyl) cyclopentanecarbonyl chloride
OR1003052-02 500 mg

1- (4-Methylphenyl) cyclopentanecarbonyl chloride

Sign In for Pricing
View Details
1- (4-Methylphenyl) cyclopentanecarbonyl chloride
OR1003052-03 1 g

1- (4-Methylphenyl) cyclopentanecarbonyl chloride

Sign In for Pricing
View Details