Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BYSL Peptide - N-terminal region

BYSL Peptide - N-terminal region

Product Specifications

Product Name Alternative

Enp1, BYSTIN

UniProt

Q13895

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BYSL Rabbit Polyclonal Antibody (orb326326) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004044

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGTGEAEEEYVGPRLSRRILQQARQQQEELEAEHGTGDKPAAPRERTTRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-100 1x 100 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-100 1x 100 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details