Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IMMT Peptide - N-terminal region

IMMT Peptide - N-terminal region

Product Specifications

Product Name Alternative

IMMT, HMP, MINOS2, PIG4, PIG52

UniProt

Q16891

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IMMT Rabbit Polyclonal Antibody (orb585116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005264170

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSCP1 Double Nickase Plasmid (h)
sc-413832-NIC 20 µg

DSCP1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
CA3, NT (Carbonic Anhydrase 3, Carbonic Anhydrase III, CA-III, Carbonate Dehydratase III) (Biotin)
MBS6467000-01 0.2 mL

CA3, NT (Carbonic Anhydrase 3, Carbonic Anhydrase III, CA-III, Carbonate Dehydratase III) (Biotin)

Sign In for Pricing
View Details
CA3, NT (Carbonic Anhydrase 3, Carbonic Anhydrase III, CA-III, Carbonate Dehydratase III) (Biotin)
MBS6467000-02 5x 0.2 mL

CA3, NT (Carbonic Anhydrase 3, Carbonic Anhydrase III, CA-III, Carbonate Dehydratase III) (Biotin)

Sign In for Pricing
View Details
NAV3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1393705 3x 1.0 µg

NAV3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rat F-box only protein 32,FBXO32;MAFbx ELISA KIT
JOT-EK1131Ra-01 96 Well

Rat F-box only protein 32,FBXO32;MAFbx ELISA KIT

Sign In for Pricing
View Details
Rat F-box only protein 32,FBXO32;MAFbx ELISA KIT
JOT-EK1131Ra-02 48 Well

Rat F-box only protein 32,FBXO32;MAFbx ELISA KIT

Sign In for Pricing
View Details