WDR46 Peptide - C-terminal region
WDR46 Peptide - C-terminal region
Product Specifications
Product Name Alternative
WDR46, BING4, C6orf11, FP221
UniProt
O15213
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WDR46 Rabbit Polyclonal Antibody (orb326455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005443
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VDVISLEQGKKEQIERLGYDPQAKAPFQPKPKQKGRSSTASLVKRKRKVM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680021-500 1x 500 µL
Cytokeratin 18 (DC10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041505-100 1x 100 µL
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP314781M 100 µg
Stabilin 2 (STAB2) (NM_017564) Human Recombinant Protein
Sign In for Pricing
View Details 