Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR46 Peptide - C-terminal region

WDR46 Peptide - C-terminal region

Product Specifications

Product Name Alternative

WDR46, BING4, C6orf11, FP221

UniProt

O15213

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR46 Rabbit Polyclonal Antibody (orb326455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005443

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDVISLEQGKKEQIERLGYDPQAKAPFQPKPKQKGRSSTASLVKRKRKVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPTX1 Rabbit Polyclonal Antibody
TA367161 100 µL

NPTX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MEIKIN activation kit by CRISPRa
GA118960 1 Kit

Human MEIKIN activation kit by CRISPRa

Sign In for Pricing
View Details
IRE1 (ERN1) Human Gene Knockout Kit (CRISPR)
KN215023RB 1 Kit

IRE1 (ERN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS625010 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS803986 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
Potassium Bromide
TRC-P695045-500G 500 g

Potassium Bromide

Sign In for Pricing
View Details