Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BOK Peptide - N-terminal region

BOK Peptide - N-terminal region

Product Specifications

Product Name Alternative

BOK, BCL2L9

UniProt

Q9UMX3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BOK Rabbit Polyclonal Antibody (orb585572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005247094

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Artocarpus integrifolia Lectin (Jackfruit) -Jacalin, AIA-,  10nm
GP-6301-10 1 mL

Colloidal Gold Conjugated Artocarpus integrifolia Lectin (Jackfruit) -Jacalin, AIA-, 10nm

Sign In for Pricing
View Details
Ultrasonic Cleaner BULC-917
BULC-917 1 Unit

Ultrasonic Cleaner BULC-917

Sign In for Pricing
View Details
TGF β2 Antibody
8C0341-AAT 50 µg

TGF β2 Antibody

Sign In for Pricing
View Details
L-beta-Imidazole Lactic Acid Monohydrate
TRC-I355000-1G 1 g

L-beta-Imidazole Lactic Acid Monohydrate

Sign In for Pricing
View Details
MED1 Human Gene Knockout Kit (CRISPR)
KN422118 1 Kit

MED1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Dffb activation kit by CRISPRa
GA201072 1 Kit

Mouse Dffb activation kit by CRISPRa

Sign In for Pricing
View Details