Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BOK Peptide - N-terminal region

BOK Peptide - N-terminal region

Product Specifications

Product Name Alternative

BOK, BCL2L9

UniProt

Q9UMX3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BOK Rabbit Polyclonal Antibody (orb585572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005247094

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Variable Volume 12 Channel Micropipette BPIP-317
BPIP-317 1 Unit

Variable Volume 12 Channel Micropipette BPIP-317

Sign In for Pricing
View Details
ZNF286B (NM_001145045) Human Over-expression Lysate
LY428660 100 µg

ZNF286B (NM_001145045) Human Over-expression Lysate

Sign In for Pricing
View Details
CHST8 (NM_001127896) Human Over-expression Lysate
LC426882 20 µg

CHST8 (NM_001127896) Human Over-expression Lysate

Sign In for Pricing
View Details
Stearic Acid
TRC-S686495-5G 5 g

Stearic Acid

Sign In for Pricing
View Details
Carburetor Ultrasonic BULC-607
BULC-607 1 Unit

Carburetor Ultrasonic BULC-607

Sign In for Pricing
View Details
SIT1 Antibody
KC-3648-01 50 μL

SIT1 Antibody

Sign In for Pricing
View Details