Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAC1 Peptide - middle region

RAC1 Peptide - middle region

Product Specifications

Product Name Alternative

RAC1, TC25, MIG5

UniProt

P63000

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAC1 Rabbit Polyclonal Antibody (orb331242) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AZIN1 polyclonal antibody
BS78587-01 50 µL

AZIN1 polyclonal antibody

Sign In for Pricing
View Details
AZIN1 polyclonal antibody
BS78587-02 100 µL

AZIN1 polyclonal antibody

Sign In for Pricing
View Details
Uncoated Human LP-a (Apolipoprotein a) ELISA Kit
MBS2571803-01 24 Tests (Limit 1)

Uncoated Human LP-a (Apolipoprotein a) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human LP-a (Apolipoprotein a) ELISA Kit
MBS2571803-02 5x 96 Tests

Uncoated Human LP-a (Apolipoprotein a) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri argG Polyclonal Antibody
MBS7138130 Inquire

Rabbit anti-Shigella flexneri argG Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human astrovirus-1 Non-structural polyprotein 1A (ORF1), partial
MBS7059162 Inquire

Recombinant Human astrovirus-1 Non-structural polyprotein 1A (ORF1), partial

Sign In for Pricing
View Details