Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC84 Peptide - N-terminal region

CCDC84 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DLNB14

UniProt

Q86UT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_940891

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVREHLSHGNLTVLYGGLLEHLASPEHKKATNKFWWENKAEVQMKEKFLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aurora B (AURKB) Rabbit Polyclonal Antibody
TA397427S 25 µL

Aurora B (AURKB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PS2 (TFF1/1091), Biotin conjugate, 0.1mg/mL
BNCB1091-100 1x 100 µL

PS2 (TFF1/1091), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ASB3 Antibody
KC-36556-01 50 μL

ASB3 Antibody

Sign In for Pricing
View Details
ASB3 Antibody
KC-36556-02 100 µL

ASB3 Antibody

Sign In for Pricing
View Details
ASB3 Antibody
KC-36556-03 1 mL

ASB3 Antibody

Sign In for Pricing
View Details
Lumiwox™ acridinium NHS ester
26000-AAT 1 mg

Lumiwox™ acridinium NHS ester

Sign In for Pricing
View Details