Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC84 Peptide - N-terminal region

CCDC84 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DLNB14

UniProt

Q86UT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_940891

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVREHLSHGNLTVLYGGLLEHLASPEHKKATNKFWWENKAEVQMKEKFLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Acetyl-2-[1-(2-naphthyl)ethyl]benzene
TRC-A186970-1G 1 g

1-Acetyl-2-[1-(2-naphthyl)ethyl]benzene

Sign In for Pricing
View Details
Trim17 Mouse Gene Knockout Kit (CRISPR)
KN518188 1 Kit

Trim17 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tcap (NM_011540) Mouse Tagged ORF Clone
MG201373 10 µg

Tcap (NM_011540) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MMP-9 Antibody
8C0275-AAT 50 µg

MMP-9 Antibody

Sign In for Pricing
View Details
Recombinant Human IL9 Protein
PDMH100029-01 20 µg

Recombinant Human IL9 Protein

Sign In for Pricing
View Details
Recombinant Human IL9 Protein
PDMH100029-02 100 µg

Recombinant Human IL9 Protein

Sign In for Pricing
View Details