Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDUA Peptide - N-terminal region

IDUA Peptide - N-terminal region

Product Specifications

Product Name Alternative

IDUA

UniProt

P35475

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IDUA Rabbit Polyclonal Antibody (orb588124) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000194

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAMBI Human Over-expression Lysate
orb1347616 100 µg

BAMBI Human Over-expression Lysate

Sign In for Pricing
View Details
LAMB3 Antibody
CSB-PA678801-01 50 μL

LAMB3 Antibody

Sign In for Pricing
View Details
LAMB3 Antibody
CSB-PA678801-02 100 µL

LAMB3 Antibody

Sign In for Pricing
View Details
RREB1 (NM_001003699) Human Over-expression Lysate
LY423986 100 µg

RREB1 (NM_001003699) Human Over-expression Lysate

Sign In for Pricing
View Details
3- (4-Chlorophenyl) -10-ethoxy-N- (4-methoxyphenyl) -2-methyl-4-thioxo-3,4,5,6-tetrahydro-2H-2,6-methano-1,3,5-benzoxadiazocine-11-carboxamide
sc-493257 5 mg

3- (4-Chlorophenyl) -10-ethoxy-N- (4-methoxyphenyl) -2-methyl-4-thioxo-3,4,5,6-tetrahydro-2H-2,6-methano-1,3,5-benzoxadiazocine-11-carboxamide

Sign In for Pricing
View Details
Rat Tmem74b Pre-designed siRNA Set A
SI214870A 1 Each

Rat Tmem74b Pre-designed siRNA Set A

Sign In for Pricing
View Details