Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGRMC2 Peptide - C-terminal region

PGRMC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DG6, PMBP

UniProt

O15173

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGRMC2 Rabbit Polyclonal Antibody (orb327253) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KPRP (NM_001025231) Human Tagged ORF Clone Lentiviral Particle
RC217678L4V 200 µL

KPRP (NM_001025231) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rotigotine hydrochloride
M11042-01 1 g

Rotigotine hydrochloride

Sign In for Pricing
View Details
Rotigotine hydrochloride
M11042-02 500 mg

Rotigotine hydrochloride

Sign In for Pricing
View Details
Rotigotine hydrochloride
M11042-03 5 mg

Rotigotine hydrochloride

Sign In for Pricing
View Details
Rotigotine hydrochloride
M11042-04 10 mg

Rotigotine hydrochloride

Sign In for Pricing
View Details
Rotigotine hydrochloride
M11042-05 25 mg

Rotigotine hydrochloride

Sign In for Pricing
View Details