PICK1 Peptide - C-terminal region
PICK1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PICK1, PRKCABP
UniProt
Q9NRD5
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PICK1 Rabbit Polyclonal Antibody (orb331455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036539
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1249057-01 0.02 mg (E-Coli)
Recombinant Synechococcus sp. 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (SynRCC307_2256)
Sign In for Pricing
View Details MBS1249057-02 0.1 mg (E-Coli)
Recombinant Synechococcus sp. 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (SynRCC307_2256)
Sign In for Pricing
View Details MBS1249057-03 0.02 mg (Yeast)
Recombinant Synechococcus sp. 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (SynRCC307_2256)
Sign In for Pricing
View Details MBS1249057-04 0.1 mg (Yeast)
Recombinant Synechococcus sp. 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (SynRCC307_2256)
Sign In for Pricing
View Details MBS1249057-05 0.02 mg (Baculovirus)
Recombinant Synechococcus sp. 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (SynRCC307_2256)
Sign In for Pricing
View Details MBS1249057-06 0.02 mg (Mammalian-Cell)
Recombinant Synechococcus sp. 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (SynRCC307_2256)
Sign In for Pricing
View Details