Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITX3 Peptide - N-terminal region

PITX3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PITX3, PTX3

UniProt

O75364

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PITX3 Rabbit Polyclonal Antibody (orb331456) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005020

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLPGGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBPMS Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C3]
TA800208AM 100 µL

RBPMS Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C3]

Sign In for Pricing
View Details
2,3-Dihydro-3-hydroxy-2-oxo Lysergide
TRC-D449560-1MG 1 mg

2,3-Dihydro-3-hydroxy-2-oxo Lysergide

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF568 conjugate, 0.1mg/mL
BNC681864-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L-Pyroglutamic Acid
TRC-P997480-25G 25 g

L-Pyroglutamic Acid

Sign In for Pricing
View Details
TAZ (WWTR1) (NM_001168278) Human Over-expression Lysate
LY433001 100 µg

TAZ (WWTR1) (NM_001168278) Human Over-expression Lysate

Sign In for Pricing
View Details
FastClick™ XFD555 Alkyne
72877-AAT 1 mg

FastClick™ XFD555 Alkyne

Sign In for Pricing
View Details