Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITX3 Peptide - N-terminal region

PITX3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PITX3, PTX3

UniProt

O75364

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PITX3 Rabbit Polyclonal Antibody (orb331456) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005020

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLPGGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LysoViewTM 594, 1000X in DMSO, Trial Size
#70084-T 1x 10 µL

LysoViewTM 594, 1000X in DMSO, Trial Size

Sign In for Pricing
View Details
1-Bromooctane(Octyl Bromide)
TRC-O273090-10G 10 g

1-Bromooctane(Octyl Bromide)

Sign In for Pricing
View Details
Corneodesmosin (CDSN) (NM_001264) Human Over-expression Lysate
LY420043 100 µg

Corneodesmosin (CDSN) (NM_001264) Human Over-expression Lysate

Sign In for Pricing
View Details
SSX2 (C-term) Rabbit Polyclonal Antibody
AP23257PU-N 100 µg

SSX2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OSBPL9 (NM_148909) Human Recombinant Protein
TP311520M 100 µg

OSBPL9 (NM_148909) Human Recombinant Protein

Sign In for Pricing
View Details
GSTA6P Mouse Monoclonal Antibody [Clone ID: 3D10]
AM06391SU-N 100 µL

GSTA6P Mouse Monoclonal Antibody [Clone ID: 3D10]

Sign In for Pricing
View Details