Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLOD2 Peptide - C-terminal region

PLOD2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PLOD2

UniProt

O00469

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLOD2 Rabbit Polyclonal Antibody (orb588146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PIFSEKACDELVEEMEHYGKWSGGKHHDSRISGGYENVPTDDIHMKQVDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A8]
TA501218BM 100 µL

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A8]

Sign In for Pricing
View Details
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody [Clone ID: UMAB292]
UM800181CF 100 µg

Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody [Clone ID: UMAB292]

Sign In for Pricing
View Details
N-Acetyl 6-Chlorotryptophan
TRC-A168430-50MG 50 mg

N-Acetyl 6-Chlorotryptophan

Sign In for Pricing
View Details
Renilla reniformis GFP
0310-1 1 mg

Renilla reniformis GFP

Sign In for Pricing
View Details
KAT2A Mouse Monoclonal Antibody [Clone ID: AT3G13]
AM09360PU-S 50 µL

KAT2A Mouse Monoclonal Antibody [Clone ID: AT3G13]

Sign In for Pricing
View Details
Ly6g Rat Monoclonal Antibody [Clone ID: RB6-8C5]
CL046P 250 µg

Ly6g Rat Monoclonal Antibody [Clone ID: RB6-8C5]

Sign In for Pricing
View Details