PLOD2 Peptide - C-terminal region
PLOD2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PLOD2
UniProt
O00469
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLOD2 Rabbit Polyclonal Antibody (orb588146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PIFSEKACDELVEEMEHYGKWSGGKHHDSRISGGYENVPTDDIHMKQVDL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY402902 100 µg
C14orf133 (VIPAS39) (NM_022067) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC741925-100 1x 100 µL
P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941776-500 1x 500 µL
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (N/A), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940789-100 1x 100 µL
GFAP (ASTRO/789), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 