Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R16B Peptide - middle region

PPP1R16B Peptide - middle region

Product Specifications

Product Name Alternative

TIMAP, ANKRD4

UniProt

Q96T49

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP1R16B Rabbit Polyclonal Antibody (orb327256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSDMD Polyclonal Antibody, HRP Conjugated
A59321-050 50 µL

GSDMD Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
PPIC Rabbit Polyclonal Antibody (Cy5.5)
orb1077582 100 µL

PPIC Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Dab1 Rabbit Polyclonal Antibody (BF647)
orb2543280 100 µL

Dab1 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Container, 86oz (2500mL), HDPE
271086W 25/CS

Container, 86oz (2500mL), HDPE

Sign In for Pricing
View Details
Human RPP21 qPCR Primer Pair
QH52553S 200 Tests

Human RPP21 qPCR Primer Pair

Sign In for Pricing
View Details
ARNT Antibody
orb127715-01 25 µg

ARNT Antibody

Sign In for Pricing
View Details