Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R16B Peptide - middle region

PPP1R16B Peptide - middle region

Product Specifications

Product Name Alternative

TIMAP, ANKRD4

UniProt

Q96T49

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP1R16B Rabbit Polyclonal Antibody (orb327256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHX36 (NM_001114397) Human Untagged Clone
SC319014 10 µg

DHX36 (NM_001114397) Human Untagged Clone

Sign In for Pricing
View Details
BAD antibody
70R-7834 100 µL

BAD antibody

Sign In for Pricing
View Details
RCL1 Blocking Peptide
MBS8308938-01 1 mg

RCL1 Blocking Peptide

Sign In for Pricing
View Details
RCL1 Blocking Peptide
MBS8308938-02 5 mg

RCL1 Blocking Peptide

Sign In for Pricing
View Details
RCL1 Blocking Peptide
MBS8308938-03 5x 5 mg

RCL1 Blocking Peptide

Sign In for Pricing
View Details
Mitofusin 1 MFN1 Mouse Monoclonal Antibody (Fluoro488)
orb3084924 100 µg

Mitofusin 1 MFN1 Mouse Monoclonal Antibody (Fluoro488)

Sign In for Pricing
View Details